PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29929.m004754
Common NameRCOM_1082530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family ARR-B
Protein Properties Length: 419aa    MW: 47538.5 Da    PI: 7.249
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29929.m004754genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.81e-22183235255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    +rl+Wt +LH++Fv+av+q+ G +k  Pk+il+ m+v+ Lt+e+v+ HLQkYRl
  29929.m004754 183 ARLVWTVDLHQKFVKAVHQI-GFDKIGPKKILDRMNVPWLTRENVAGHLQKYRL 235
                    69******************.********************************8 PP

2Response_reg57.57.6e-20201271109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl+vd +p+  ++l+++l+k  y +va++  +++al++l+ ++  +D++++D+  ++mdG++ll++i  +  ++p+i  +a    + +++ ++ Ga
  29929.m004754  20 VLVVDNDPTWSRILEKMLKKCSY-QVATCG-SRDALNMLRGRKdeYDIVICDVTTSDMDGFRLLEHIGLKM-DCPVINASALXXASALQKGVRHGA 112
                    89*********************.888665.56788888555556**********************6644.8*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ ++el++
  29929.m004754 113 CDYLLKPIRMKELRN 127
                    ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.13E-2717139IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23004.6E-3317140No hitNo description
SMARTSM004487.6E-1918129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011030.25619133IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.2E-1720128IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.70E-1721133No hitNo description
Gene3DG3DSA:1.10.10.606.5E-26180240IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-19183235IPR006447Myb domain, plants
SuperFamilySSF466896.9E-15183239IPR009057Homeodomain-like
PfamPF002493.2E-7185234IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016310Biological Processphosphorylation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0016301Molecular Functionkinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MMIHGFSSPL NNDFPAGLRV LVVDNDPTWS RILEKMLKKC SYQVATCGSR DALNMLRGRK  60
DEYDIVICDV TTSDMDGFRL LEHIGLKMDC PVINASALXX ASALQKGVRH GACDYLLKPI  120
RMKELRNIWQ HVFRKRIHEV RECEILGSDQ ACDGPLLRGE DLASVKKRKY ADQKADISSA  180
KMARLVWTVD LHQKFVKAVH QIGFDKIGPK KILDRMNVPW LTRENVAGHL QKYRLYLSRL  240
QTEKDLKFAG LYSSVLKKQI GLRIACVYLN KIASNFINFS VSPSRDSPRS ISTGYSCNIR  300
QNYASNGGGG SSGFTGNDLI LHNVENRSYE TDEEEIVSMP LIKDQERIVS LPLAEPWTST  360
TVDDPDPWNS RTSQTGFSRS SESEVRFAAF DSTFLFGKSR DDEEEHKNDE EDYMDEDPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-15178240163ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572151.10.0PREDICTED: two-component response regulator ARR11
SwissprotQ5N6V81e-100ORR26_ORYSJ; Two-component response regulator ORR26
TrEMBLB9RMP90.0B9RMP9_RICCO; Two-component sensor histidine kinase bacteria, putative
STRINGPOPTR_0010s06290.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.12e-91response regulator 11